Recombinant Human Claudin 14 protein (ab153239)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQ AAR
    • Amino acids
      29 to 81
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI851731
    • Claudin 14
    • Claudin-14
    • CLD14_HUMAN
    • CLDN 14
    • CLDN14
    • DFNB 29
    • DFNB29
    • Human CLDN14 gene
    • MGC109472
    • OTTHUMP00000109046
    • OTTHUMP00000109049
    • OTTMUSP00000021531
    • UNQ777/PRO1571
    see all
  • Function
    Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
  • Tissue specificity
    Liver, kidney. Also found in ear.
  • Involvement in disease
    Defects in CLDN14 are the cause of deafness autosomal recessive type 29 (DFNB29) [MIM:605608]. DFNB29 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities
    Belongs to the claudin family.
  • Cellular localization
    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • ab153239 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up