Recombinant Human Claudin 2 protein (ab112383)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQ AA
    • Molecular weight
      31 kDa including tags
    • Amino acids
      29 to 80

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Useful for Antibody Production and Protein Array
  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    ab112383 is best used within three months from the date of receipt.Useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Claudin-2
    • Claudin2
    • CLD2_HUMAN
    • CLDN 2
    • CLDN2
    • OTTHUMP00000023793
    • SP 82
    • SP82
    see all
  • Function
    Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
  • Sequence similarities
    Belongs to the claudin family.
  • Cellular localization
    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • ab112383 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab112383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up