Recombinant Human Claudin 2 protein (ab112383)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQ AA
    • Molecular weight
      31 kDa including tags
    • Amino acids
      29 to 80

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Useful for Antibody Production and Protein Array
  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    ab112383 is best used within three months from the date of receipt.Useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Claudin-2
    • Claudin2
    • CLD2_HUMAN
    • CLDN 2
    • CLDN2
    • OTTHUMP00000023793
    • SP 82
    • SP82
    see all
  • Function
    Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
  • Sequence similarities
    Belongs to the claudin family.
  • Cellular localization
    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Recombinant Human Claudin 2 protein images

  • ab112383 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Claudin 2 protein (ab112383)

ab112383 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up