Recombinant Human Claudin 4 protein (ab114389)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14493
    • SpeciesHuman
    • SequenceMASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGL WMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVV GGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNP LVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV
    • Molecular weight49 kDa including tags
    • Amino acids1 to 209

Specifications

Our Abpromise guarantee covers the use of ab114389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114389 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Claudin-4
    • Claudin4
    • CLD4_HUMAN
    • CLDN 4
    • CLDN4
    • Clostridium perfringens enterotoxin receptor
    • Clostridium perfringens enterotoxin receptor 1
    • CPE R
    • CPE receptor
    • CPE-R
    • CPE-receptor
    • CPER
    • CPETR
    • CPETR 1
    • CPETR1
    • hCPE R
    • WBSCR8
    • Williams Beuren syndrome chromosome region 8 protein
    • Williams-Beuren syndrome chromosomal region 8 protein
    see all
  • FunctionPlays a major role in tight junction-specific obliteration of the intercellular space.
  • Involvement in diseaseNote=CLDN4 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similaritiesBelongs to the claudin family.
  • Cellular localizationCell junction > tight junction. Cell membrane.
  • Information by UniProt

Recombinant Human Claudin 4 protein images

  • ab114389 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Claudin 4 protein (ab114389)

ab114389 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"