Recombinant Human Claudin 4 protein (ab114389)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGL WMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVV GGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNP LVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 209

Specifications

Our Abpromise guarantee covers the use of ab114389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114389 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Claudin-4
    • Claudin4
    • CLD4_HUMAN
    • CLDN 4
    • CLDN4
    • Clostridium perfringens enterotoxin receptor
    • Clostridium perfringens enterotoxin receptor 1
    • CPE R
    • CPE receptor
    • CPE-R
    • CPE-receptor
    • CPER
    • CPETR
    • CPETR 1
    • CPETR1
    • hCPE R
    • WBSCR8
    • Williams Beuren syndrome chromosome region 8 protein
    • Williams-Beuren syndrome chromosomal region 8 protein
    see all
  • Function
    Plays a major role in tight junction-specific obliteration of the intercellular space.
  • Involvement in disease
    Note=CLDN4 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities
    Belongs to the claudin family.
  • Cellular localization
    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • ab114389 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up