Recombinant Human Claudin 7 protein (ab112275)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQAT R
    • Molecular weight
      31 kDa including tags
    • Amino acids
      31 to 81
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112275 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CEPTR L2
    • CEPTRL 2
    • CEPTRL2
    • Claudin 1
    • Claudin 9
    • Claudin-7
    • Claudin1
    • Claudin7
    • Claudin9
    • CLD7_HUMAN
    • CLDN 7
    • CLDN-7
    • CLDN7
    • Clostridium perfringens enterotoxin receptor like 2
    • CPETR L2
    • CPETRL 2
    • CPETRL2
    • Hs.84359
    see all
  • Function
    Plays a major role in tight junction-specific obliteration of the intercellular space.
  • Tissue specificity
    Expressed in kidney, lung and prostate. Isoform 1 seems to be predominant, except in some normal prostate samples, where isoform 2 is the major form. Down-regulated in breast cancers, including ductal carcinoma in situ (DCIS), lobular carcinoma in situ (LCIS) and invasive ductal carcinoma (IDC) (at protein level), as well as in several cancer cell lines. Loss of expression correlates with histological grade, occurring predominantly in high-grade lesions.
  • Sequence similarities
    Belongs to the claudin family.
  • Post-translational
    modifications
    Phosphorylated.
  • Cellular localization
    Cell membrane. Lateral cell membrane. Cell junction > tight junction. Co-localizes with EPCAM at the lateral cell membrane and tight junction.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab112275 at approximately 31.24kDa stained with Coomassie Blue.

References

ab112275 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112275.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up