Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionA8K7I4
    • SpeciesHuman
    • SequenceALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQV CFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAP
    • Molecular weight37 kDa including tags
    • Amino acids677 to 776

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CaCC
    • CaCC-1
    • CACC1
    • Calcium dependent chloride channel 1
    • Calcium-activated chloride channel family member 1
    • Calcium-activated chloride channel protein 1
    • Calcium-activated chloride channel regulator 1
    • Chloride channel calcium activated family member 1
    • Chloride channel regulator 1
    • CLCA family member 1 chloride channel regulator
    • CLCA1
    • CLCA1_HUMAN
    • CLCRG1
    • GOB5
    • hCaCC-1
    • hCLCA1
    see all
  • FunctionMay be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC.
  • Tissue specificityHighly expressed in small intestine and colon namely in intestinal basal crypt epithelia and goblet cells, and appendix. Weakly expressed in uterus, testis and kidney. Expressed in the airways epithelium of both asthmatic andhealthy patients. Expressed in the bronchial epithelium, especially in mucus-producing goblet cells. Expressed in normal turbinate mucosa and nasal polyp. Expressed in.
  • Sequence similaritiesBelongs to the CLCR family.
    Contains 1 VWFA domain.
  • Post-translational
    modifications
    Glycosylated.
    The 125-kDa product is processed and yields to two cell-surface-associated subunits, a 90-kDa protein and a group of 37-to 41-kDa proteins.
  • Cellular localizationSecreted > extracellular space. Cell membrane. Protein that remains attached to the plasma membrane appeared to be predominantly localized to microvilli.
  • Information by UniProt

Recombinant Human CLCA1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human CLCA1 protein (ab114722)

ab114722 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"