Overview

  • Product name
    Recombinant Human CLCA2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFV GIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKG F
    • Amino acids
      300 to 400
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 35 kDa form
    • CaCC-3
    • CaCC3
    • Calcium-activated chloride channel family member 2
    • Calcium-activated chloride channel protein 3
    • Calcium-activated chloride channel regulator 2
    • Calcium-activated chloride channel-2
    • Chloride channel, calcium activated, family member 2
    • Clca2
    • CLCA2_HUMAN
    • hCaCC-3
    • hCLCA2
    see all
  • Function
    Play a role in modulating chloride current across the plasma membrane in a calcium-dependent manner, and cell adhesion. Involved in basal cell adhesion and/or stratification of squamous epithelia. May act as a tumor suppressor in breast and colorectal cancer. Plays a key role for cell adhesion in the beginning stages of lung metastasis via the binding to ITGB4.
  • Tissue specificity
    Expressed in cornea, skin, vagina, esophagus, and larynx (at protein level). Expressed in trachea and mammary gland. Weakly expressed in testis and kidney. Highly expressed in corneal epithelium, colon and trachea. Moderately expressed in brain, urogenital organs, bladder, uterus and prostate. Highly expressed in tissues containing stratified epithelium including cornea, esophagus, larynx, skin and vagina than those tissues which contain only epithelial monolayers. Expressed in normal breast epithelium but not in breast cancer. Highly expressed during epithelial stratification. Expressed in endothelial cells of lung. Expressed selectively in endothelia of small pulmonary arteries, arterioles, and subpleural and interlobular venules.
  • Sequence similarities
    Belongs to the CLCR family.
    Contains 1 VWFA domain.
  • Post-translational
    modifications
    The 141 kDa mature form is shedded, producing a 109 kDa form and a 35 kDa form.
    N-glycosylated.
  • Cellular localization
    Cell membrane. Basal cell membrane. Cell junction and Secreted. Remains associated to the 35 kDa form until an unidentified event triggers the release.
  • Information by UniProt

Images

  • ab160591 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up