Overview

  • Product name
    Recombinant Human CLCA3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVFSLKVILFLSLLLSPVLKSSLVTLNNNGYDGIVIAINPSVPEDEKLIQ NIKEMVTEASTYLFHATKQRAYFRNVSILIPMTYKSKSEYLIPKQESYDQ ADVIVADLYLKYGDDPYTLQYGQCGDKGQYIHFTPNFLLTNNLATYGPRG RVFVHEWAHLRWGVFDEYNVDQPFYISRRNTTEATRCSTRITVYMVLNEC KGASCIARPFRRDSKTGLYEAKCTFIPKRSQTAKESIVFMQNLDSVTEFC TEKTHNKEAPNL
    • Amino acids
      1 to 262
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium-activated chloride channel regulator family member 3
    • Chloride channel accessory 3 pseudogene
    • chloride channel calcium activated 3
    • Clca1
    • Clca2
    • CLCA3P
    • Gob 5
    • gob5
    • hCLCA3
    • mCLCA3
    see all
  • Relevance
    mCLCA3 (alias gob-5) is the third murine member of the family of calcium-activated chloride channels (CLCA-family). mCLCA3 plays a role in diseases with secretory dysfunctions, including asthma and cystic fibrosis. The mCLCA3 protein is located in mucin granule membranes of goblet cells of the intestinal, respiratory and reproductive tracts. It is also secreted into the mucin layer on mucosal membranes. The protein appears to be involved in the synthesis, condensation or secretion of mucins.
  • Cellular localization
    Secreted

Images

  • ab160586 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up