Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGD TAVGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 99

Specifications

Our Abpromise guarantee covers the use of ab114666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein. Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chloride channel 3
    • Chloride channel protein 3
    • Chloride channel, voltage-sensitive 3
    • Chloride transporter ClC 3
    • Chloride transporter ClC-3
    • Chloride transporter ClC3
    • chloride voltage-gated channel 3
    • ClC 3
    • ClC-3
    • ClC3
    • CLCN 3
    • CLCN3
    • CLCN3_HUMAN
    • DKFZp564I0463
    • H(+)/Cl(-) exchange transporter 3
    see all
  • Function
    Mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to the acidification of the endosome and synaptic vesicle lumen, and may thereby affect vesicle trafficking and exocytosis. May play an important role in neuronal cell function through regulation of membrane excitability by protein kinase C. It could help neuronal cells to establish short-term memory.
  • Tissue specificity
    Expressed primarily in tissues derived from neuroectoderm. Within the brain, its expression is particularly evident in the hippocampus, olfactory cortex, and olfactory bulb. Highly expressed in aortic and coronary vascular smooth muscle cells, and aortic endothelial cells. Also expressed in tracheal and alveolar epithelial cells, and intima and media of the pulmonary vessels. Expressed in bronchus and colon (at protein level).
  • Sequence similarities
    Belongs to the chloride channel (TC 2.A.49) family. ClC-3/CLCN3 subfamily.
    Contains 2 CBS domains.
  • Domain
    Isoform 2 contains a C-terminal PDZ-binding motif mediating the interaction with GOPC.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane. Early endosome membrane. Late endosome membrane. Cytoplasmic vesicle > secretory vesicle membrane. Isoform 1 is localized mainly in early and late endosomes and Membrane. Early endosome membrane. Late endosome membrane. Golgi apparatus membrane. Isoform 2 partially colocalized with isoform 1 but is mainly enriched in the Golgi.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114666 on a 12.5% gel stained with Coomassie Blue.

References

ab114666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up