Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGCRGSLCCCCRWCCCCGERETRTPEELTILGETQEEEDEILPRKDYES LDYDRCINDPYLEVLETMDNKKGRRYEAVKWMVVFAIGVCTGLVGLFVDF FVRLFTQLKFGVVQTSVEECSQKGCLALSLLELLGFNLTFVFLASLLVLI EPVAAGSGIPEVKCYLNGVKVPGIVRLRTLLCKVLGVLFSVAGGLFVGKE GPMIHSGSVVGAGLPQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGV AAAFGAPIGGTLFSLEEGSSFWNQGLTWKVLFCSMSATFTLNFFRSGIQF GSWGSFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVIGGLLGAT FNCLNKRLAKYRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECR QMSSSSQIGNDSFQLQVTEDVNSSIKTFFCPNDTYNDMATLFFNPQESAI LQLFHQDGTFSPVTLALFFVLYFLLACWTYGISVPSGLFVPSLLCGAAFG RLVANVLKSYIGLGHIYSGTFALIGAAAFLGGVVRMTISLTVILIESTNE ITYGLPIMVTLMVAKWTGDFFNKGIYDIHVGLRGVPLLEWETEVEMDKLR ASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGN QLISNNIKFKKSSILTRAGEQRKRSQSMKSYPSSELRNMCDEHIASEEPA EKEDLLQQMLERRYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLILRSQL VTLLVRGVCYSESQSSASQPRLSYAEMAEDYPRYPDIHDLDLTLLNPRMI VDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITR HNLTYEFLQARLRQHYQTI
    • Amino acids
      1 to 869
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chloride channel 6
    • Chloride channel protein 6
    • Chloride channel voltage sensitive 6
    • Chloride transport protein 6
    • ClC 6
    • ClC-6
    • ClC6
    • CLCN6
    • CLCN6_HUMAN
    • KIAA0046
    see all
  • Function
    Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.
  • Tissue specificity
    Testis, ovary, small intestine, brain and skeletal muscle. Low level expression in aortic and coronary vascular smooth muscle cells, and aortic endothelial cells. Isoform 3 is only detected in kidney.
  • Sequence similarities
    Belongs to the chloride channel (TC 2.A.49) family. ClC-6/CLCN6 subfamily.
    Contains 2 CBS domains.
  • Post-translational
    modifications
    N-glycosylated on several asparagine residues.
  • Cellular localization
    Endosome membrane. Detected in detergent-resistant lipid rafts.
  • Information by UniProt

Images

  • ab158136 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up