Recombinant Human CLEC10A protein (ab152045)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEG FKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDL KKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQ LKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGF QNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQ TSQESHVDHHHHHH
    • Molecular weight
      30 kDa including tags
    • Amino acids
      61 to 316
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab152045 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 13 (macrophage derived)
    • C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 14 (macrophage derived)
    • C type lectin domain family 10, member A
    • C type lectin superfamily member 14
    • C-type lectin domain family 10 member A
    • C-type lectin superfamily member 14
    • CD301
    • CD301 antigen
    • CD301A
    • CLC10_HUMAN
    • CLEC10A
    • CLECSF13
    • CLECSF14
    • HML
    • HML2
    • Lectin
    • Macrophage C type lectin
    • MACROPHAGE GALACTOSE-TYPE C-TYPE
    • Macrophage lectin 2
    • Macrophage lectin 2 (calcium dependent)
    • MGL
    • Mgl1
    see all
  • Function
    Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab152045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up