Recombinant Human CLEC1B protein (ab153339)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QYCTDMNATLLKIDNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSV ISENMFEFLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCERKAGMTKVDQ LP
    • Amino acids
      128 to 229
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1810061I13Rik
    • C type lectin domain family 1 member B
    • C type lectin like receptor 2
    • C-type lectin domain family 1 member B
    • C-type lectin domain family 1, member B
    • C-type lectin-like receptor 2
    • C-type lectin-like receptor-2
    • CLC1B_HUMAN
    • CLEC 2
    • CLEC 2B
    • CLEC-2
    • CLEC1B
    • CLEC2
    • CLEC2B
    • PRO1384
    • QDED721
    see all
  • Function
    Acts as a receptor for the platelet-aggregating snake venom protein rhodocytin. Rhodocytin binding leads to tyrosine phosphorylation and this promotes the binding of spleen tyrosine kinase (Syk) and initiation of downstream tyrosine phosphorylation events and activation of PLC-gamma-2. Acts as an attachment factor for human immunodeficiency virus type 1 (HIV-1) and facilitates its capture by platelets.
  • Tissue specificity
    Expressed preferentially in the liver. Also expressed in immune cells of myeloid origin and on the surface of platelets.
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Post-translational
    modifications
    Glycosylated.
    Phosphorylated on tyrosine residue in response to rhodocytin binding.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab153339 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up