Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ6UXN8
    • SpeciesHuman
    • SequenceKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSS AHNSSPCPNNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEE MDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLPAERSQS ANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSV
    • Amino acids57 to 241

Specifications

Our Abpromise guarantee covers the use of ab125991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 28.8% Guanidine HCl

  • ReconstitutionReconstitute with water to desired concentration.

General Info

  • Alternative names
    • C type lectin domain family 9, member A
    • C-type lectin domain family 9 member A
    • CLC9A_HUMAN
    • CLEC9A
    • DNGR1
    • HEEE9341
    • PRO34046
    • UNQ9341
    see all
  • FunctionFunctions as an endocytic receptor on a small subset of myeloid cells specialized for the uptake and processing of material from dead cells. Recognizes filamentous form of actin in association with particular actin-binding domains of cytoskeletal proteins, including spectrin, exposed when cell membranes are damaged, and mediate the cross-presentation of dead-cell associated antigens in a Syk-dependent manner.
  • Tissue specificityIn peripheral blood highly restricted on the surface of BDCA31(+) dendritic cells and on a small subset of CD14(+) and CD16(-) monocytes.
  • Sequence similaritiesContains 1 C-type lectin domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localizationMembrane.
  • Information by UniProt

References for Recombinant Human CLEC9A protein (ab125991)

ab125991 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"