Recombinant Human CLECL1 protein (ab165721)

Overview

  • Product name
    Recombinant Human CLECL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYW IAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
    • Amino acids
      82 to 167
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C-type lectin-like 1
    • C-type lectin-like domain family 1
    • DC-associated lectin-1
    • DCAL-1
    • DCAL1
    • Dendritic cell associated lectin 1
    • Dendritic cell-associated lectin 1
    • Dendritic cell-associated lectin-1
    • Type II transmembrane protein DCAL1
    see all
  • Relevance
    CLECL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 (IL4) production.
  • Cellular localization
    Cell membrane; Single-pass type II membrane protein.

Images

  • ab165721 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up