Recombinant Human CLECSF6 protein (ab162371)

Overview

  • Product name
    Recombinant Human CLECSF6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASL LIFFLLLAISFFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE TAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQEEQ DFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPN ERCVVLNFRKSPKRWGWNDVNCLGPQRSVCEMMKIHL
    • Amino acids
      1 to 237
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 6
    • C type lectin
    • C type lectin DDB27
    • C type lectin superfamily 6
    • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 6
    • C-type lectin superfamily member 6
    • C-type lectin DDB27
    • C-type lectin domain family 4 member A
    • C-type lectin domain family 4, member A
    • C-type lectin domain family 4, member a2
    • C-type lectin superfamily member 6
    • CLC4A_HUMAN
    • Clec4a
    • Clec4a2
    • CLECSF6
    • DCIR
    • Dcir1
    • DDB27
    • Dendritic cell immunoreceptor
    • HDCGC13P
    • Lectin like immunoreceptor
    • Lectin, C-type, superfamily member 6
    • Lectin-like immunoreceptor
    • LLIR
    see all
  • Function
    May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.
  • Tissue specificity
    Expressed in dendritic cells, myeloid cells, B-cells and HL-60 cells (at protein level). TNF alpha, IL-1 alpha, and LPS, down-regulated expression at the surface of neutrophils (at protein level). Expressed preferentially in hematopoietic tissues. Expressed in peripheral blood leukocytes, neutrophils, moderate quantities in spleen, lymph node, and bone marrow, and at very low levels in thymus. Expressed in Ag-presenting cells (DC, monocytes, macrophages and B-cells), as well as on granulocytes. Expression was decreased in DC by signals inducing its maturation (e.g. CD40 ligand, LPS, and TNF alpha).
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Domain
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162371 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up