Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAEEQPQVELFVKAGSDGAKIGNCPFSQRL FMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI EEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLE KGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNL LPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIE LAYEQVAKALK
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 241
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.88% Sodium chloride

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Chloride channel ABP
    • Chloride intracellular channel 1
    • Chloride intracellular channel protein 1
    • CLIC 1
    • CLIC1
    • CLIC1_HUMAN
    • G6
    • hRNCC
    • NCC 27
    • NCC27
    • Nuclear chloride ion channel 27
    • Nuclear chloride ion channel protein
    • p64CLCP
    • Regulatory nuclear chloride ion channel protein
    • RNCC protein
    see all
  • Function
    Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Involved in regulation of the cell cycle.
  • Tissue specificity
    Expression is prominent in heart, placenta, liver, kidney and pancreas.
  • Sequence similarities
    Belongs to the chloride channel CLIC family.
    Contains 1 GST C-terminal domain.
  • Domain
    Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.
  • Post-translational
    modifications
    Hydrogen peroxide treatment causes a conformation change, leading to dimerization and formation of an intramolecular disulfide bond between Cys-24 and Cys-59.
  • Cellular localization
    Nucleus. Nucleus membrane. Cytoplasm. Cell membrane. Mostly in the nucleus including in the nuclear membrane. Small amount in the cytoplasm and the plasma membrane. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain.
  • Information by UniProt

References

ab172845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up