Overview

  • Product name
    Recombinant Human CLIC2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSGLRPGTQVDPEIELFVKAGSDGESIGNC PFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELK TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKE ANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLT LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCP EDKEIENTYANVAKQKS
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 247
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106875 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Chloride intracellular channel 2
    • Chloride intracellular channel protein 2
    • CLIC 2b
    • CLIC2
    • CLIC2_HUMAN
    • CLIC2b
    • MRXS32
    • OTTHUMP00000196471
    • XAP 121
    • XAP121
    see all
  • Function
    Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Modulates the activity of RYR2 and inhibits calcium influx.
  • Tissue specificity
    Detected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle.
  • Sequence similarities
    Belongs to the chloride channel CLIC family.
    Contains 1 GST C-terminal domain.
  • Domain
    Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.
  • Cellular localization
    Cytoplasm. Membrane. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab106875.

References

ab106875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up