Overview

  • Product name
    Recombinant Human CLIC2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSGLRPGTQVDPEIELFVKAGSDGESIGNC PFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELK TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKE ANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLT LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCP EDKEIENTYANVAKQKS
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 247
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106875 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Chloride intracellular channel 2
    • Chloride intracellular channel protein 2
    • CLIC 2b
    • CLIC2
    • CLIC2_HUMAN
    • CLIC2b
    • MRXS32
    • OTTHUMP00000196471
    • XAP 121
    • XAP121
    see all
  • Function
    Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Modulates the activity of RYR2 and inhibits calcium influx.
  • Tissue specificity
    Detected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle.
  • Sequence similarities
    Belongs to the chloride channel CLIC family.
    Contains 1 GST C-terminal domain.
  • Domain
    Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.
  • Cellular localization
    Cytoplasm. Membrane. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain.
  • Information by UniProt

Recombinant Human CLIC2 protein images

  • 15% SDS-PAGE analysis of 3 µg ab106875.

References for Recombinant Human CLIC2 protein (ab106875)

ab106875 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up