Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVT TVDMTRKP EELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPR YPHLSPKYKESFDVGCNL FAKFSAYIKNTQKEANKNFEKSLLKEFKRL DDYLNTPLLDEIDPDSAEEPPVSRRLFL DGDQLTLADCSLLPKLNIIK VAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPED KEIENTYANV AKQKS

Specifications

Our Abpromise guarantee covers the use of ab88002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88002 was purified by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Chloride intracellular channel 2
    • Chloride intracellular channel protein 2
    • CLIC 2b
    • CLIC2
    • CLIC2_HUMAN
    • CLIC2b
    • MRXS32
    • OTTHUMP00000196471
    • XAP 121
    • XAP121
    see all
  • FunctionCan insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Modulates the activity of RYR2 and inhibits calcium influx.
  • Tissue specificityDetected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle.
  • Sequence similaritiesBelongs to the chloride channel CLIC family.
    Contains 1 GST C-terminal domain.
  • DomainMembers of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.
  • Cellular localizationCytoplasm. Membrane. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain.
  • Information by UniProt

References for Recombinant Human CLIC2 protein (ab88002)

ab88002 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"