Recombinant Human CLIC4 protein (ab104744)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y696
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGE SIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITF NSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIK NSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLD GNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEF TNTCPSDKEVEIAYSDVAKRLTK
    • Molecular weight31 kDa including tags
    • Amino acids1 to 253
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104744 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Chloride intracellular channel 4
    • Chloride intracellular channel 4 (mitochondrial)
    • Chloride intracellular channel 4 like
    • Chloride intracellular channel protein 4
    • Clic4
    • CLIC4_HUMAN
    • CLIC4L
    • DKFZP566G223
    • FLJ38640
    • H1
    • HUH1
    • Intracellular chloride ion channel protein p64H1
    • MC3S5
    • mtCLIC
    • p64H1
    see all
  • FunctionCan insert into membranes and form poorly selective ion channels that may also transport chloride ions. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Promotes cell-surface expression of HRH3. Has alternate cellular functions like a potential role in angiogenesis or in maintaining apical-basolateral membrane polarity during mitosis and cytokinesis. Could also promote endothelial cell proliferation and regulate endothelial morphogenesis (tubulogenesis).
  • Tissue specificityDetected in epithelial cells from colon, esophagus and kidney (at protein level). Expression is prominent in heart, kidney, placenta and skeletal muscle.
  • Sequence similaritiesBelongs to the chloride channel CLIC family.
    Contains 1 GST C-terminal domain.
  • DomainMembers of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.
  • Cellular localizationCytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasmic vesicle membrane. Nucleus matrix. Cell membrane. Mitochondrion. Cell junction. Colocalized with AKAP9 at the centrosome and midbody. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain. Present in an intracellular vesicular compartment that likely represent trans-Golgi network vesicles.
  • Information by UniProt

Recombinant Human CLIC4 protein images

  • 15% SDS-PAGE (3µg).

References for Recombinant Human CLIC4 protein (ab104744)

ab104744 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Used this purified protein as a positive control to determine antibody specificity to CLIC4 in western blots. Very low amount (0.5 ug/lane) of protein was sufficient to yield a positive result. Purified CLIC1 protein (ab95486) from Abcam was used as a negative control.
Username

Abcam user community

Verified customer

Submitted Jun 16 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"