Recombinant Human CLINT1 protein (ab153007)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKA TFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTS AREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERK KAKKNKDKYVGVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAFPFSDK LGELSDKIGSTIDDTISKFRRKDREDSPERCSDSDEEKKARRGRSPKGEF KDEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASP DQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADF GSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPA VELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTNTV GLGLPMSRSQNTDMVQKSVSKTLPSTWSDPSVNISLDNLLPGMQPSKPQQ PSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMP MSMPNVMTGTMGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGM PNIAMTSGTVQPKQDAFANFANFSK
    • Amino acids
      1 to 625
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Clathrin interacting protein
    • Clathrin interactor 1
    • Clathrin-interacting protein localized in the trans-Golgi region
    • Clint
    • CLINT 1
    • CLINT1
    • ENTH
    • Enthoprotin
    • EPN4
    • EPN4_HUMAN
    • Epsin 4
    • Epsin related protein
    • Epsin-4
    • Epsin-related protein
    • EpsinR
    see all
  • Function
    Binds to membranes enriched in phosphatidylinositol-4,5-biphosphate (PtdIns(4,5)P2). May have a role in transport via clathrin-coated vesicles from the trans-Golgi network to endosomes. Stimulates clathrin assembly.
  • Tissue specificity
    Ubiquitously expressed at low to intermediate levels.
  • Sequence similarities
    Belongs to the epsin family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > perinuclear region. Membrane. Cytoplasmic vesicle > clathrin-coated vesicle. Found throughout the cell, with the exception of the cell surface. Concentrated in the perinuclear region and associated with clathrin-coated vesicles close to the trans-Golgi network.
  • Information by UniProt

Images

  • ab153007 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up