Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49759
    • SpeciesHuman
    • SequenceMRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSK MCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNH SSKSSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVEDDEEGHLI CQSGDVLSARYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYC EAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLSTYD FIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEV ILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPK HMIQKTRKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDVEHERL FDLIQKMLEYDPAKRITLREALKHPFFDLLKKSI
    • Molecular weight79 kDa including tags
    • Amino acids1 to 484

Specifications

Our Abpromise guarantee covers the use of ab114706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDC like kinase 1
    • CDC-like kinase 1
    • CDC28/CDC2 like kinase
    • CLK
    • CLK/STY
    • Clk1
    • CLK1_HUMAN
    • Dual specificity protein kinase CLK1
    • Protein tyrosine kinase STY
    • STY
    see all
  • FunctionPhosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. Phosphorylates serines, threonines and tyrosines.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. Lammer subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylates on all three types of residues.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human CLK1 protein images

  • 12.5% SDS-PAGE showing ab114706 at approximately 79.31 kDa stained with Coomassie Blue.

References for Recombinant Human CLK1 protein (ab114706)

ab114706 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"