Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEHSSAGRY VRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFD LLKKK
    • Amino acids
      377 to 481
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163543 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI987988
    • C85119
    • CDC like kinase 4
    • CDC-like kinase 4
    • CLK4
    • CLK4_HUMAN
    • DKFZp686A20267
    • Dual specificity protein kinase CLK4
    • OTTMUSP00000005756;
    • OTTMUSP00000005757
    • OTTMUSP00000041113
    • Protein serine threonine kinase Clk4
    • RP23-9N7.1
    see all
  • Function
    Dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. Phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex and may be a constituent of a network of regulatory mechanisms that enable SR proteins to control RNA splicing. Phosphorylates SRSF1 and SRSF3. Required for the regulation of alternative splicing of MAPT/TAU. Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells.
  • Tissue specificity
    Expressed in liver, kidney, heart, muscle, brain and endothelial cells.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. Lammer subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylates on all three types of residues.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163543 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163543 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163543.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up