Recombinant Human CLLD8/SETDB2 protein (ab153545)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      HPRTAKTEKCPPKFSNNPKELTMETKYDNISRIQYHSVIRDPESKTAIFQ HNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFED
    • Amino acids
      451 to 550
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153545 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C13orf4
    • Chromosome 13 open reading frame 4
    • Chronic lymphocytic leukemia deletion region 8
    • Chronic lymphocytic leukemia deletion region gene 8
    • Chronic lymphocytic leukemia deletion region gene 8 protein
    • Clld8
    • CLLL8
    • Gm293
    • H3-K9-HMTase
    • Histone H3-K9 methyltransferase
    • Histone-lysine N-methyltransferase SETDB2
    • KMT1F
    • Lysine N-methyltransferase 1F
    • Probable histone-lysine N-methyltransferase H3 lysine-9 specific
    • SEB2
    • SET domain bifurcated 2
    • SET domain protein, bifurcated, 2
    • SETB2_HUMAN
    • Setdb2
    see all
  • Function
    Histone methyltransferase involved in left-right axis specification in early development and mitosis. Specifically trimethylates 'Lys-9' of histone H3 (H3K9me3). H3K9me3 is a specific tag for epigenetic transcriptional repression that recruits HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Contributes to H3K9me3 in both the interspersed repetitive elements and centromere-associated repeats. Plays a role in chromosome condensation and segregation during mitosis.
  • Tissue specificity
    Ubiquitous. Highest expression in heart, testis and ovary.
  • Sequence similarities
    Belongs to the histone-lysine methyltransferase family.
    Contains 1 MBD (methyl-CpG-binding) domain.
    Contains 1 pre-SET domain.
    Contains 1 SET domain.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • ab153545 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153545 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153545.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up