Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16740
    • SpeciesHuman
    • SequenceMPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLF LQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMG SLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQL YNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDE PTLVQKEPVEAAPAAEPVPAST
    • Molecular weight24 kDa
    • Amino acids57 to 277

Specifications

Our Abpromise guarantee covers the use of ab124872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab124872 is purified by proprietary chromatographic techniques and sterile filtered.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.03% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ATP dependent protease ClpAP (E coli) proteolytic subunit
    • ATP dependent protease ClpAP proteolytic subunit
    • ATP dependent protease ClpAP proteolytic subunit human
    • ATP dependent proteolytic subunit homolog
    • ATP dependent proteolytic subunit homolog (E coli)
    • Caseinolytic peptidase ATP dependent proteolytic subunit homolog
    • Caseinolytic protease ATP dependent proteolytic subunit E coli
    • clpP
    • ClpP caseinolytic peptidase ATP dependent proteolytic subunit
    • ClpP caseinolytic peptidase ATP dependent proteolytic subunit homolog
    • CLPP_HUMAN
    • Endopeptidase Clp
    • mitochondrial
    • Putative ATP dependent Clp protease proteolytic subunit
    • Putative ATP dependent Clp protease proteolytic subunit mitochondrial
    • Putative ATP-dependent Clp protease proteolytic subunit
    see all
  • FunctionClp cleaves peptides in various proteins in a process that requires ATP hydrolysis. Clp may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.
  • Tissue specificityPredominantly expressed in skeletal muscle. Intermediate levels in heart, liver and pancreas. Low in brain, placenta, lung and kidney.
  • Sequence similaritiesBelongs to the peptidase S14 family.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt

References for Recombinant Human CLPP protein (ab124872)

ab124872 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"