Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLF LQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMG SLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQL YNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDE PTLVQKEPVEAAPAAEPVPAST
    • Molecular weight
      24 kDa
    • Amino acids
      57 to 277

Specifications

Our Abpromise guarantee covers the use of ab124872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab124872 is purified by proprietary chromatographic techniques and sterile filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.03% DTT, 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ATP dependent protease ClpAP (E coli) proteolytic subunit
    • ATP dependent protease ClpAP proteolytic subunit
    • ATP dependent protease ClpAP proteolytic subunit human
    • ATP dependent proteolytic subunit homolog
    • ATP dependent proteolytic subunit homolog (E coli)
    • Caseinolytic peptidase ATP dependent proteolytic subunit homolog
    • Caseinolytic protease ATP dependent proteolytic subunit E coli
    • clpP
    • ClpP caseinolytic peptidase ATP dependent proteolytic subunit
    • ClpP caseinolytic peptidase ATP dependent proteolytic subunit homolog
    • CLPP_HUMAN
    • Endopeptidase Clp
    • mitochondrial
    • Putative ATP dependent Clp protease proteolytic subunit
    • Putative ATP dependent Clp protease proteolytic subunit mitochondrial
    • Putative ATP-dependent Clp protease proteolytic subunit
    see all
  • Function
    Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. Clp may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.
  • Tissue specificity
    Predominantly expressed in skeletal muscle. Intermediate levels in heart, liver and pancreas. Low in brain, placenta, lung and kidney.
  • Sequence similarities
    Belongs to the peptidase S14 family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

References

ab124872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up