Recombinant Human CLPTM1L protein (ab164317)

Overview

  • Product name
    Recombinant Human CLPTM1L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARR PKLQLSVYTTTRSHLGAENNIDLVLNVEDFDVESKFERTVNVSVPKKTRN NGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDT QQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKM IQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKVSLGRLR FWIHMQDAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLF DFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVL VPAGVGAAIELWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQA MKYLSYLLYPLCVGGAVYSLLNIKYKSWYSWLINSFVNGVYAFGFLFMLP QLFVNYKLKSVAHLPWKAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDD VVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD
    • Amino acids
      1 to 538
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C130052I12Rik
    • Cisplatin resistance related protein 9
    • Cisplatin resistance related protein CRR9p
    • Cisplatin resistance-related protein 9
    • Cleft lip and palate transmembrane protein 1 like protein
    • Cleft lip and palate transmembrane protein 1-like protein
    • CLP1L_HUMAN
    • CLPTM1 like
    • CLPTM1 like protein
    • CLPTM1-like protein
    • CLPTM1L
    • CRR9
    • CRR9p
    • DKFZp666M1010
    • DKFZp761M2324
    • FLJ14400
    • FLJ32533
    • MGC36304
    • OTTHUMP00000220655
    • RGD1307896
    see all
  • Function
    Enhances cisplatin-mediated apoptosis, when overexpressed.
  • Sequence similarities
    Belongs to the CLPTM1 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164317 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up