Recombinant Human CLSTN1 protein (ab182805)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFARVNKHKPWLEPTYHGIVTEN DNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIHGQNVPFDAV VVDKSTGEGVIRSKEKLDCELQKDYSFTIQAYDCGKGPDGTNVKKSHKAT VHIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILRVEAVDADCSPQFSQI CSYEIITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATE DVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVASV QATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTM GLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGPFGR KKETILCSSDKTDMNRHHYSLYVHGCRLIFLFRQDPSEEKKYRPAEFHWK LNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPLHPSKIETQL VVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKL ADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELD KAMQHISYLNSRQFPTPGIRRLKITSTIKCFNEATCISVPPVDGYVMVLQ PEEPKISLSGVHHFARAASEFESSEGVFLFPELRIISTITREVEPEGDGA EDPTVQESLVSEEIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQKGIE VSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKFKLICSELNG RYISNEFKVEVNVIHTANPMEHANHMAAQPQFVHPEHRSFVDLSGHNLAN PHPFAVVPST
    • Molecular weight
      96 kDa including tags
    • Amino acids
      29 to 859
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      The extracellular domain of CLSTN1 constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_055759.

Specifications

Our Abpromise guarantee covers the use of ab182805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab182805 is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Buffer also contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • Alc alpha
    • Alc-alpha
    • Alcadein alpha
    • Alcadein alpha 1
    • Alcadein-alpha
    • alcalpha1
    • alcalpha2
    • Alzheimer related cadherin like protein
    • Alzheimer-related cadherin-like protein
    • C-terminal fragment 1-alpha
    • Cadherin related family member 12
    • Calsyntenin 1
    • Calsyntenin1
    • CDHR12
    • CLSTN 1
    • Clstn1
    • CS1
    • CSTN1
    • CSTN1_HUMAN
    • CTF1-alpha
    • FLJ32258
    • KIAA0911
    • Non classical cadherin XB31alpha
    • Non classical cadherin XB31alpha1
    • Non-classical cadherin XB31alpha
    • PIK3CD
    • SAlc-alpha
    • XB31alpha
    see all
  • Function
    Induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation. In complex with APBA2 and C99, a C-terminal APP fragment, abolishes C99 interaction with PSEN1 and thus APP C99 cleavage by gamma-secretase, most probably through stabilization of the direct interaction between APBA2 and APP. The intracellular fragment AlcICD suppresses APBB1-dependent transactivation stimulated by APP C-terminal intracellular fragment (AICD), most probably by competing with AICD for APBB1-binding. May modulate calcium-mediated postsynaptic signals.
  • Tissue specificity
    Expressed in the brain and, a lower level, in the heart, skeletal muscle, kidney and placenta. Accumulates in dystrophic neurites around the amyloid core of Alzheimer disease senile plaques (at protein level).
  • Sequence similarities
    Contains 2 cadherin domains.
  • Domain
    The cytoplasmic domain is involved in interaction with APBA2, as well as the binding of synaptic Ca(2+).
  • Post-translational
    modifications
    Proteolytically processed under normal cellular conditions. A primary zeta-cleavage generates a large extracellular (soluble) N-terminal domain (sAlc) and a short C-terminal transmembrane fragment (CTF1). A secondary cleavage catalyzed by presenilin gamma-secretase within the transmembrane domain releases the beta-Alc-alpha chain in the extracellular milieu and produces an intracellular fragment (AlcICD). This processing is strongly suppressed in the tripartite complex formed with APBA2 and APP, which seems to prevent the association with PSEN1.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane. Cell projection. Cell junction > synapse > postsynaptic cell membrane. Nucleus. Neurite tips. Localized in the postsynaptic membrane of both excitatory and inhibitory synapses (By similarity). The AlcICD fragment is translocated to the nucleus upon interaction with APBB1.
  • Information by UniProt

References

ab182805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up