Recombinant Human CLSTN3 protein (ab182807)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFNKANKHKPWIEAEYQGIVMEN DNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGVPFEAVILDKATGEGL IRAKEPVDCEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNE FAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQICYYEILTPNT PFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADDAEVEIQVKP TCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSH VAKGCDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDS SLIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGK KEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLE QVCDDEWHHYALNLEFPTVTLYTDGISFDPALIHDNGLIHPPRREPALMI GACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESR EVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHAL QHVAYMNTLRFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDA PQILLSGTAHFARPAVDFEGTNGVPLFPDLQITCSISHQVEAKKDESWQG TVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLLLDTTSLQQRGLELTN TSAYLTIAGVESITVYEEILRQARYRLRHGAALYTRKFRLSCSEMNGRYS SNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSHR NSMIPSA
    • Molecular weight
      96 kDa including tags
    • Amino acids
      20 to 847
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal (NP_055533).

Specifications

Our Abpromise guarantee covers the use of ab182807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • Alc beta
    • Alcadein beta
    • Alcbeta
    • Cadherin related family member 14
    • Calsyntenin 3
    • CDHR14
    • CSTN3
    • KIAA0726
    • MGC131797
    • MGC138488
    see all
  • Relevance
    CLSTN3 may modulate calcium-mediated postsynaptic signals. It forms a complex with APBA2 and APP, stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation (by similarity).
  • Cellular localization
    Cell Membrane (Single-pass type I membrane protein), Endoplasmic reticulum and Golgi Apparatus.

References

ab182807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up