Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYE NGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR
    • Amino acids
      164 to 263
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CMAS
    • CMP N acetylneuraminic acid synthase
    • CMP Neu5Ac synthetase
    • CMP NeuNAc synthetase
    • CMP sialic acid synthetase
    • CMP-N-acetylneuraminic acid synthase
    • CMP-N-acetylneuraminic acid synthetase
    • CMP-NeuNAc synthase
    • CSS
    • Cytidine 5' monophosphate N acetylneuraminic acid synthetase
    • Cytidine 5-prime-monophosphate N-acetylneuraminic acid synthetase
    • Cytidine monophosphate N acetylneuraminic acid synthetase
    • N acylneuraminate cytidylyltransferase
    • N-acylneuraminate cytidylyltransferase
    • NEUA_HUMAN
    see all
  • Function
    Catalyzes the activation of N-acetylneuraminic acid (NeuNAc) to cytidine 5'-monophosphate N-acetylneuraminic acid (CMP-NeuNAc), a substrate required for the addition of sialic acid. Has some activity toward NeuNAc, N-glycolylneuraminic acid (Neu5Gc) or 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN).
  • Tissue specificity
    Ubiquitously expressed. Expressed in pancreas, kidney, liver, skeletal muscle, lung, placenta, brain, heart, colon, PBL, small intestine, ovary, testis, prostate, thymus and spleen.
  • Pathway
    Amino-sugar metabolism; N-acetylneuraminate metabolism.
  • Sequence similarities
    Belongs to the CMP-NeuNAc synthase family.
  • Domain
    The BC2 (basic cluster 2) motif is necessary and sufficient for the nuclear localization and contains the catalytic active site. The localization in the nucleus is however not required for the enzyme activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163271 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up