Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYL RGALGRLKVAQVILALIAFICIETIMACSPCEGLYFFEFVSCSAFVVTGV LLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAE IAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSR PEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA
    • Amino acids
      1 to 234
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165529 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chemokine like factor super family 4
    • Chemokine-like factor superfamily member 4
    • CKLF-like MARVEL transmembrane domain containing 4
    • CKLF4
    • CKLFSF4
    • CMTM4
    see all
  • Relevance
    CMTM4 is encoded by a gene belonging to the chemokine-like factor gene superfamily. This is a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules.
  • Cellular localization
    Membrane

Images

  • ab165529 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165529 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165529.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up