Overview

  • Product name
    Recombinant Human CNAP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKL RACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
    • Amino acids
      1240 to 1339
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2810406C15Rik
    • 2810465G24Rik
    • CAP-D2
    • CAPD2
    • CEP2
    • CEP250
    • Chromosome condensation-related SMC-associated protein 1
    • Chromosome-associated protein D2
    • CNAP1
    • CND1
    • Condensin
    • Condensin complex subunit 1
    • eg7
    • hCAP-D2
    • hCAPD2
    • KIAA0159
    • mKIAA0159
    • NCAPD2
    • non-SMC condensin I complex, subunit D2
    • XCAP D2 homolog
    see all
  • Relevance
    CNAP1/hCAP-D2 is a regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condensed chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. It may target the condensin complex to DNA via its C-terminal domain (referenced from Swissprot).
  • Cellular localization
    Nuclear and cytoplasmic.

Images

  • ab160714 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up