Overview

  • Product name
    Recombinant Human CNGA4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLI ILVCRACFPDLQHGYLVAWLVLDYTSDLLYLLDMVVRFHTGFLEQGILVV DKGRISSRYVRTWSFFLDLASLMPTDVVYVRLGPHTPTLRLNRFLRAPRL FEAFDRTETRTAYPNAFRIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDA WVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAREEEYLFMVGD FLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLE RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQ NCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDG ITQYAVLGAGLYFGEISIINIKGNMSGNRRTANIKSLGYSDLFCLSKEDL REVLSEYPQAQTIMEEKGREILLKMNKLDVNAEAAEIALQEATESRLRGL DQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWPMPEDLAEADD EGEPEEGTSKDEEGRASQEGPPGPE
    • Amino acids
      1 to 575
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cgn2
    • CNCA2
    • CNG 4
    • CNG channel alpha 4
    • CNG4
    • CNG5
    • Cnga4 cyclic nucleotide gated channel alpha 4
    • CNGB2
    • Cyclic nucleotide gated cation channel alpha 4
    • Cyclic nucleotide gated channel alpha 4
    • Cyclic nucleotide gated channel beta 2
    • Cyclic nucleotide gated olfactory channel subunit OCNC2
    • MGC126168
    • MGC126169
    • MGC130316
    • OCNC2
    • OCNCb
    • OCNCBETA
    see all
  • Relevance
    Second messenger, cAMP, causes the opening of cation-selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab158148 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up