Overview

  • Product name
    Recombinant Human CNIH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNP LVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGL YDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS
    • Amino acids
      1 to 144
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 0610007J15
    • CNIH
    • CNIH_HUMAN
    • CNIH1
    • CNIL
    • Cornichon homolog (Drosophila)
    • MGC117156
    • Protein cornichon homolog
    • T-cell growth-associated molecule 77
    • TGAM77
    • UNQ155/PRO181
    see all
  • Function
    Involved in the selective transport and maturation of TGF-alpha family proteins.
  • Tissue specificity
    Highly expressed in heart, liver, skeletal muscle, pancreas, adrenal medulla and cortex, thyroid, testis, spleen, appendix, peripheral blood lymphocytes and bone marrow. Lower expression found in brain, placenta, lung, kidney, ovary, small intestine, stomach, lymph node, thymus and fetal liver.
  • Sequence similarities
    Belongs to the cornichon family.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane. Located primarily in the ER; may cycle between the ER and the Golgi apparatus.
  • Information by UniProt

Images

  • ab160859 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up