Recombinant Human CNKSR1 protein (ab160906)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VLCAAVELLHEADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHED GPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGL
    • Amino acids
      111 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CNK
    • CNK homolog protein 1
    • CNK1
    • CNKR1_HUMAN
    • CNKSR1
    • Connector enhancer of kinase suppressor of ras 1
    • Connector enhancer of KSR 1
    • Connector enhancer of KSR like
    • Connector enhancer of KSR-like
    • Connector enhancer of KSR1
    • hCNK1
    • KSR
    see all
  • Function
    May function as an adapter protein or regulator of Ras signaling pathways.
  • Sequence similarities
    Belongs to the CNKSR family.
    Contains 1 CRIC domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 PH domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab160906 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up