Recombinant Human CNN2 protein (ab114920)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99439
    • SpeciesHuman
    • SequencePKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDN SSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDC
    • Molecular weight36 kDa including tags
    • Amino acids193 to 290

Specifications

Our Abpromise guarantee covers the use of ab114920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Calponin 2
    • Calponin H2
    • Calponin H2, smooth muscle
    • Calponin-2
    • Cnn2
    • CNN2_HUMAN
    • Neutral calponin
    • smooth muscle
    see all
  • FunctionThin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
  • Tissue specificityHeart and smooth muscle.
  • Sequence similaritiesBelongs to the calponin family.
    Contains 3 calponin-like repeats.
    Contains 1 CH (calponin-homology) domain.
  • Information by UniProt

Recombinant Human CNN2 protein images

  • 12.5% SDS-PAGE showing ab114920 at approximately 36.41kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CNN2 protein (ab114920)

ab114920 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry which has been forwarded to the scientific support team. I am sorry we do not provide larger vial sizes. We can offer a discount if you purchase 5 vials or more on one order (of the same product, or different products). I...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"