Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMF PHRSEKDMLASPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSL SQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIG IPSRTNSMSSSGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQ AFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRREGSGNPTPLIN PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS NLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGM VTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFA SPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYM NGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYY FFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
    • Amino acids
      1 to 540
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCR4 associated factor 2
    • CCR4 NOT transcription complex subunit 2
    • CCR4-associated factor 2
    • CCR4-NOT transcription complex subunit 2
    • CDC36
    • CNOT2
    • CNOT2_HUMAN
    • HSPC131
    • MSTP046
    • Negative regulator of transcription 2
    • NOT2
    • NOT2 (negative regulator of transcription 2 yeast) homolog
    • NOT2H
    see all
  • Function
    The CCR4-NOT complex functions as general transcription regulation complex.
  • Tissue specificity
    Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the CNOT2/3/5 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab159006 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up