Overview

  • Product name
    Recombinant Human CNOT3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKK EIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab116798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCR4 associated factor 3
    • CCR4-associated factor 3
    • CCR4-NOT transcription complex subunit 3
    • CNOT3
    • CNOT3_HUMAN
    • KIAA0691
    • LENG2
    • Leukocyte receptor cluster member 2
    • negative regulator of transcription 3, S. cerevisiae, homolog of
    • NOT3
    • NOT3 (negative regulator of transcription 3, yeast) homolog
    • NOT3H
    see all
  • Function
    The CCR4-NOT complex functions as general transcription regulation complex.
  • Tissue specificity
    Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the CNOT2/3/5 family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116798 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab116798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up