Overview

  • Product name
    Recombinant Human CNOT3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKK EIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab116798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCR4 associated factor 3
    • CCR4-associated factor 3
    • CCR4-NOT transcription complex subunit 3
    • CNOT3
    • CNOT3_HUMAN
    • KIAA0691
    • LENG2
    • Leukocyte receptor cluster member 2
    • negative regulator of transcription 3, S. cerevisiae, homolog of
    • NOT3
    • NOT3 (negative regulator of transcription 3, yeast) homolog
    • NOT3H
    see all
  • Function
    The CCR4-NOT complex functions as general transcription regulation complex.
  • Tissue specificity
    Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the CNOT2/3/5 family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human CNOT3 protein images

  • 12.5% SDS-PAGE showing ab116798 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human CNOT3 protein (ab116798)

ab116798 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up