Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLF ILRGLPG SGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYK RLDEDLAAYCRRRDIR ILVLDDTNHERERLEQLFEMADQYQYQVVLVE PKTAWRLDCAQLKEKNQWQLSADDL KKLKPGLEKDFLPLYFGWFLTKK SSETLRKAGQVFLEELGNHKAFKKELRQFVPGDE PREKMDLVTYFGKR PPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISA LFVTP KTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQ TG LDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVR AIFTGYYGKGK PVPTQGSRKGGALQSCTII
    • Amino acids4 to 421

Specifications

Our Abpromise guarantee covers the use of ab92238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 43 µl distilled water.

General Info

  • Alternative names
    • 2''
    • 2'3' cyclic nucleotide 3' phosphodiesterase
    • 3''-cyclic-nucleotide 3''-phosphodiesterase
    • CN37_HUMAN
    • CNP
    • CNP 1
    • CNP1
    • CNPase
    see all
  • Sequence similaritiesBelongs to the cyclic nucleotide phosphodiesterase family.
  • Cellular localizationMembrane. Melanosome. Firmly bound to membrane structures of brain white matter. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human CNPase protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human CNPase protein (ab92238)

ab92238 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"