Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLF ILRGLPGSGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRL DEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQYQYQVVLVEPKTA WRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLR KAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCT TKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARVELS EQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILR QEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKP VPTQGSRKGGALQSCTII
    • Amino acids
      4 to 421

Specifications

Our Abpromise guarantee covers the use of ab92238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 43 µl distilled water.

General Info

  • Alternative names
    • 2''
    • 2'3' cyclic nucleotide 3' phosphodiesterase
    • 3''-cyclic-nucleotide 3''-phosphodiesterase
    • CN37_HUMAN
    • CNP
    • CNP 1
    • CNP1
    • CNPase
    see all
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family.
  • Cellular localization
    Membrane. Melanosome. Firmly bound to membrane structures of brain white matter. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab92238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab92238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up