Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQG IRIDSDISGTLKFACESIVEEYEDELIEFFSREADNVKDKLCSKRTDLCD HALHISHDEL
    • Amino acids
      73 to 182
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Canopy 2 homolog (zebrafish)
    • Cnpy2
    • CNPY2_HUMAN
    • MIR-interacting saposin-like protein
    • MSAP
    • Protein canopy homolog 2
    • Putative secreted protein ZSIG9
    • TMEM4
    • Transmembrane protein 4
    • UNQ1943/PRO4426
    • ZSIG9
    see all
  • Function
    Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.
  • Tissue specificity
    Expressed in different tissues. Highest levels are detected in adult placenta, liver and pancreas.
  • Sequence similarities
    Belongs to the canopy family.
    Contains 1 saposin B-type domain.
  • Cellular localization
    Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab160949 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up