Recombinant Human CNTF Receptor alpha protein (ab158151)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWH LRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVL HGSKIMVCEKDP
    • Amino acids
      47 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ciliary neurotrophic factor receptor
    • Ciliary neurotrophic factor receptor alpha
    • Ciliary neurotrophic factor receptor subunit alpha
    • CNTF receptor subunit alpha
    • CNTFR
    • CNTFR Alpha
    • CNTFR-alpha
    • CNTFR_HUMAN
    see all
  • Function
    Binds to CNTF. The alpha subunit provides the receptor specificity.
  • Tissue specificity
    Nervous system and skeletal muscle.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158151 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up