Recombinant human CNTF Receptor alpha protein (ab191640)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLNGS QLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYP KGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLF STIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRL EVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYA GKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTST TSSLAPPPTTKICDPGELGSGGGP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      23 to 346
    • Tags
      His tag C-Terminus
    • Additional sequence information
      AAH01492.

Specifications

Our Abpromise guarantee covers the use of ab191640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA.
    Immobilized Human CNTF Receptor alpha at 10 μg/ml (100 μl/well) can bind biotinylated Human CNTF with a linear ranger of 3.2 - 100 ng/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.4
    Constituents: 5% Trehalose, 95% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Ciliary neurotrophic factor receptor
    • Ciliary neurotrophic factor receptor alpha
    • Ciliary neurotrophic factor receptor subunit alpha
    • CNTF receptor subunit alpha
    • CNTFR
    • CNTFR Alpha
    • CNTFR-alpha
    • CNTFR_HUMAN
    see all
  • Function
    Binds to CNTF. The alpha subunit provides the receptor specificity.
  • Tissue specificity
    Nervous system and skeletal muscle.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab191640 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 45-48 kDa due to glycosylation.

References

ab191640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up