Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEENVFWECKANGRPKPTYKWLKNGEPLLTRDRIQIEQGTLNITIVNLSD AGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTLLKRVTLVKVGGEVVIE CKPKASPKPVYTWKKGRDILKENERITISEDGNLRIINVTKSDAGSYTCI ATNHFGTASSTGNLVVKDPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLD IVFTWSFNGHLIDFDRDGDHFERVGGDSAGDLMIRNIQLKHAGKYVCMVQ TSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITM YVIQARTPFSVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANV IGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITWETVPEELQN GRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGV FNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKN RGRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKA YNSAGTGPSSATVNVTTRKPPPSQPPGNIIWNSSDSKIILNWDQVKALDN ESEVKGYKVLYRWNRQSSTSVIETNKTSVELSLPFDEDYIIEIKPFSDGG DGSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISLTARSSL
    • Amino acids
      1 to 697
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AXCAM
    • Axonal associated cell adhesion molecule
    • BIG 2
    • BIG-2
    • Brain derived immunoglobulin superfamily protein 2
    • Brain-derived immunoglobulin superfamily protein 2
    • Cntn4
    • CNTN4_HUMAN
    • CNTN4A
    • contactin 4
    • Contactin-4
    • Neural cell adhesion protein BIG 2
    • SCA16
    see all
  • Function
    Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity. May be involved in synaptogenesis.
  • Tissue specificity
    Mainly expressed in brain. Highly expressed in cerebellum and weakly expressed in corpus callosum, caudate nucleus, amygdala and spinal cord. Also expressed in testis, pancreas, thyroid, uterus, small intestine and kidney. Not expressed in skeletal muscle. Isoform 2 is weakly expressed in cerebral cortex.
  • Involvement in disease
    A chromosomal aberration involving CNTN4 has been found in a boy with characteristic physical features of 3p deletion syndrome (3PDS). Translocation t(3;10)(p26;q26). 3PDS is a rare contiguous gene disorder involving the loss of the telomeric portion of the short arm of chromosome 3 and characterized by developmental delay, growth retardation, and dysmorphic features.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. Contactin family.
    Contains 4 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cell membrane. Secreted.
  • Information by UniProt

Images

  • ab165645 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165645 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up