Recombinant Human CNTNAP4 protein (ab164759)

Overview

  • Product name
    Recombinant Human CNTNAP4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPV TVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA
    • Amino acids
      1145 to 1244
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CASPR 4
    • CASPR4
    • Cell recognition molecule Caspr4
    • Cell recognition protein CASPR4
    • CNTNAP 4
    • CNTNAP4
    • CNTP4_HUMAN
    • Contactin associated protein like 4
    • Contactin-associated protein-like 4
    • KIAA1763
    see all
  • Sequence similarities
    Belongs to the neurexin family.
    Contains 2 EGF-like domains.
    Contains 1 F5/8 type C domain.
    Contains 1 fibrinogen C-terminal domain.
    Contains 4 laminin G-like domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164759 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up