Overview

  • Product name
    Recombinant Human CoCoA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGI FKVEAACVRDYHTFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQF RYVNRQGQVCGQSPPFQFREPRPMDELVTLEEADGGSDILLVVPKATVLQ NQLDESQQERNDLMQLKLQLEGQVTELRSRVQELERALATARQEHTELME QYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVE LDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDL KEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQE LAASSQQKATLLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLH LKEEKCQWSKERAGLLQSVEAEKDKILKLSAEILRLEKAVQEERTQNQVF KTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQEEKQELLEYM RKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSEDESPEDMRLP PYGLCERGDPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAE DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPAT PTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE
    • Amino acids
      1 to 691
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium binding and coiled coil domain 1
    • CALCOCO1
    • Calphoglin
    • Coiled coil coactivator protein
    • Coiled coil leucine zipper coactivator 1
    • Coiled coil transcriptional coactivator
    • Inorganic pyrophosphatase activator
    • KIAA1536
    • PP13275
    • Sarcoma antigen NY-SAR-3
    see all
  • Relevance
    Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. Involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. Functions as a secondary coactivator in LEF1 mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions.
  • Cellular localization
    Cytoplasm. Nucleus. Note: shuttles between nucleus and cytoplasm.

Images

  • ab163621 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up