Recombinant Human Cofilin 2 protein (ab111635)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASGVTVNDEVIKVFNDMKVRKSSTQEEIK KRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTG IKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 166
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab111635 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.04% DTT, 0.29% Sodium chloride

General Info

  • Alternative names
    • CFL 2
    • CFL2
    • COF2_HUMAN
    • Cofilin
    • Cofilin 2 muscle
    • Cofilin muscle
    • Cofilin muscle isoform
    • Cofilin-2
    • Cofilin2
    • muscle isoform
    • NEM 7
    • NEM7
    see all
  • Function
    Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods.
  • Tissue specificity
    Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
  • Involvement in disease
    Defects in CFL2 are the cause of nemaline myopathy type 7 (NEM7) [MIM:610687]. A form of nemaline myopathy. Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-or rod-like structures in muscle fibers on histologic examination. Nemaline myopathy type 7 presents at birth with hypotonia and generalized weakness. Major motor milestones are delayed, but independent ambulation is achieved.
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal.
  • Cellular localization
    Nucleus matrix. Cytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human Cofilin 2 protein images

  • 15% SDS-PAGE showing ab111635 at approximately 20.9kDa (3µg).

References for Recombinant Human Cofilin 2 protein (ab111635)

ab111635 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up