Recombinant Human Cofilin 2 protein (ab114614)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVE EAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLV FIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLG EKLGGNVVVSLEGKPL
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 166

Specifications

Our Abpromise guarantee covers the use of ab114614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114614 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CFL 2
    • CFL2
    • COF2_HUMAN
    • Cofilin
    • Cofilin 2 muscle
    • Cofilin muscle
    • Cofilin muscle isoform
    • Cofilin-2
    • Cofilin2
    • muscle isoform
    • NEM 7
    • NEM7
    see all
  • Function
    Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods.
  • Tissue specificity
    Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
  • Involvement in disease
    Defects in CFL2 are the cause of nemaline myopathy type 7 (NEM7) [MIM:610687]. A form of nemaline myopathy. Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-or rod-like structures in muscle fibers on histologic examination. Nemaline myopathy type 7 presents at birth with hypotonia and generalized weakness. Major motor milestones are delayed, but independent ambulation is achieved.
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal.
  • Cellular localization
    Nucleus matrix. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab114614 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114614 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up