Recombinant Human Cofilin 2 protein (ab114614)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9Y281
    • SpeciesHuman
    • SequenceMASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVE EAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLV FIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLG EKLGGNVVVSLEGKPL
    • Molecular weight44 kDa including tags
    • Amino acids1 to 166

Specifications

Our Abpromise guarantee covers the use of ab114614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114614 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CFL 2
    • CFL2
    • COF2_HUMAN
    • Cofilin
    • Cofilin 2 muscle
    • Cofilin muscle
    • Cofilin muscle isoform
    • Cofilin-2
    • Cofilin2
    • muscle isoform
    • NEM 7
    • NEM7
    see all
  • FunctionControls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods.
  • Tissue specificityIsoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
  • Involvement in diseaseDefects in CFL2 are the cause of nemaline myopathy type 7 (NEM7) [MIM:610687]. A form of nemaline myopathy. Nemaline myopathies are muscular disorders characterized by muscle weakness of varying severity and onset, and abnormal thread-or rod-like structures in muscle fibers on histologic examination. Nemaline myopathy type 7 presents at birth with hypotonia and generalized weakness. Major motor milestones are delayed, but independent ambulation is achieved.
  • Sequence similaritiesBelongs to the actin-binding proteins ADF family.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal.
  • Cellular localizationNucleus matrix. Cytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human Cofilin 2 protein images

  • ab114614 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human Cofilin 2 protein (ab114614)

ab114614 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"