Recombinant Human Cofilin protein (ab87958)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILE EGKEILVG DVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKED LVFIFWAPESAPLKSKMI YASSKDAIKKKLTGIKHELQANCYEEVKDR CTLAEKLGGSAVISLEGKPL

Specifications

Our Abpromise guarantee covers the use of ab87958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab87958 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • 18 kDa phosphoprotein
    • CFL
    • CFL 1
    • CFL1
    • COF1_HUMAN
    • Cofilin
    • Cofilin 1
    • Cofilin 1 non muscle
    • Cofilin non muscle isoform
    • Cofilin-1
    • epididymis secretory protein Li 15
    • HEL-S-15
    • non-muscle isoform
    • p18
    see all
  • FunctionControls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods.
  • Tissue specificityWidely distributed in various tissues.
  • Sequence similaritiesBelongs to the actin-binding proteins ADF family.
    Contains 1 ADF-H domain.
  • Post-translational
    modifications
    Phosphorylated on Ser-3 in resting cells.
  • Cellular localizationNucleus matrix. Cytoplasm > cytoskeleton. Almost completely in nucleus in cells exposed to heat shock or 10% dimethyl sulfoxide.
  • Information by UniProt

References for Recombinant Human Cofilin protein (ab87958)

ab87958 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"