Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WDRRPDTTAPLTDRQTDSVLELKAAAENLPVPAELPIEDLCSLTSQSLPI ELTSVVPESTEDILLKGFTSLGMEEERIETAQQFFSWFAKLQTQMDQDEG
    • Amino acids
      25 to 124
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COG complex subunit 3
    • Cog3
    • COG3_HUMAN
    • Component of golgi transport complex 3
    • Component of oligomeric Golgi complex 3
    • Conserved oligomeric Golgi complex subunit 3
    • OTTHUMP00000018352
    • p94
    • SEC34
    • SEC34 S. cerevisiae homolog of
    • SEC34, S. cerevisiae, homolog of
    • Tethering factor SEC34
    • Vesicle docking protein SEC34 homolog
    • Vesicle-docking protein SEC34 homolog
    see all
  • Function
    Involved in ER-Golgi transport.
  • Tissue specificity
    Widely expressed with highest levels in pancreas and testis and lowest levels in lung.
  • Sequence similarities
    Belongs to the COG3 family.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Associated with the peripheral membrane of cis/medial cisternae.
  • Information by UniProt

Images

  • ab164406 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up