Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNIL VAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQE LFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHV NIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGP ACPEGGRAETQAEPPSVGP
    • Amino acids
      1 to 219
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164578 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • COG complex subunit 8
    • Component of oligomeric golgi complex 8
    • Conserved oligomeric Golgi complex component 8 dependent on RIC1
    • DOR1
  • Relevance
    COG8 is a component of the conserved oligomeric Golgi (COG) complex. This is a multiprotein complex that plays a structural role in the Golgi apparatus and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins and whose symptoms include severe psychomotor retardation, failure to thrive, seizures and dairy and wheat product intolerance. It is required for normal Golgi function.
  • Cellular localization
    Golgi apparatus; Peripheral membrane protein.

Images

  • ab164578 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164578 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164578.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up