Recombinant Human Coilin protein (ab112377)

Overview

  • Product name
    Recombinant Human Coilin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGK FDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEP
    • Molecular weight
      37 kDa including tags
    • Amino acids
      477 to 575

Specifications

Our Abpromise guarantee covers the use of ab112377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    ab112377 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CLN 80
    • CLN80
    • COIL
    • COIL_HUMAN
    • Coilin
    • Coilin p80
    • p80
    • P80 coilin
    see all
  • Function
    Is a component of the nuclear coiled bodies (CBS) which are involved in the function or assembly/disassembly of nucleoplasmic snRNPs. During mitosis, CBS disassemble, coinciding with a mitotic-specific phosphorylation of p80 coilin.
  • Tissue specificity
    Found in all the cell types examined.
  • Sequence similarities
    Belongs to the coilin family.
  • Cellular localization
    Nucleus. Nuclear coiled body located in the interchromatin space between the nucleolus and the nucleus.
  • Information by UniProt

Recombinant Human Coilin protein images

  • ab112377 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Coilin protein (ab112377)

ab112377 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up