Recombinant Human COL14A1 protein (ab159782)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TRLRYNVISHDSIQISWKAPRGKFGGYKLLVTPTSGGKTNQLNLQNTATK AIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
    • Amino acids
      34 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collagen alpha 1(XIV) chain
    • Collagen type XIV alpha 1
    • Collagen type XIV alpha 1 (undulin)
    • UND
    • Undulin
    • Undulin (fibronectin tenascin related)
    see all
  • Relevance
    COL14A1 (Collagen, Type XIV, alpha 1) also known as undulin is a large glycoprotein of the interstitial extracellular matrix, which plays a role in integrating collagen bundles. It is associated with mature interstitial collagen fibrils.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix.

Images

  • ab159782 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up