Recombinant Human COL24A1 protein (ab166050)

Overview

  • Product name
    Recombinant Human COL24A1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKA TFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL
    • Amino acids
      1626 to 1714
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Collagen alpha 1(XXIV) chain
    • Collagen type XXIV alpha 1
    • MGC142214
    • OTTHUMP00000058978
  • Relevance
    COL24A1 (Collagen type XXIV alpha 1) is coexpressed with type I collagen in the developing bone and eye. It may contribute to the regulation of type I collagen fibrillogenesis at specific anatomical locations during fetal development.

Images

  • ab166050 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up